Current Location:Home > Products > Adenovirus
Premade Adenovirus with ORF of CD300 molecule-like family member g (CD300LG), transcript variant 3 with C terminal Flag and His tag.

Premade Adenovirus with ORF of CD300 molecule-like family member g (CD300LG), transcript variant 3 with C terminal Flag and His tag.

Gene No.: NM_001168323
Cat No.: VH886629
Gene Name: CD300LG
Gene Length: 822 bp
Price: Quote400-077-2566
Turnaround Time: Inquire
Verify: No

  • Product Information
  • DNA Sequence
  • Protein Sequence
  • Protein Validation
  • Note To Purchase

Product name: Premade Adenovirus of Human ORFs


Specifications: Titer:≥1×10E12vp/mLVolume500ul


Shipping & Storage Conditions

Product(s) shipped on dry ice. Once received, please store at -80for long-term storage. Please note, Aliquot to avoid repeated freezing and thawing that can decrease the viral titer. Prior to use, please melt it(or them) at 4and mix gently to ensure a uniform concentration of components.

Once an aliquot is thawed, it may be stored at 4°C for several weeks without significant loss of biological activity.


Storage BufferPBS


Biosafety levelBiosafety level (BSL)-2


Shelf life:1 year from date of receipt under proper storage conditions


NoteIf you have any questions about how to use the product, please refer to our adenovirus manual or contact our technical support. Our email address is techsupport@wzbioscience.com.

ATGCGGCTTCTGGTCCTGCTATGGGGTTGCCTGCTGCTCCCAGGTTATGAAGCCCTGGAGGGCCCAGAGGAAATCAGCGGGTTCGAAGGGGACACTGTGTCCCTGCAGTGCACCTACAGGGAAGAGCTGAGGGACCACCGGAAGTACTGGTGCAGGAAGGGTGGGATCCTCTTCTCTCGCTGCTCTGGCACCATCTATGCAGAAGAAGAAGGCCAGGAGACAATGAAGGGCAGGGTGTCCATCCGTGACAGCCGCCAGGAGCTCTCGCTCATTGTGACCCTGTGGAACCTCACCCTGCAAGACGCTGGGGAGTACTGGTGTGGGGTCGAAAAACGGGGCCCCGATGAGTCTTTACTGATCTCTCTGTTCGTCTTTCCAGCTTCTCCTGGGCTCTACCCGGCAGCCACCACAGCCAAGCAGGGGAAGACAGGGGCTGAGGCCCCTCCATTGCCAGGGACTTCCCAGTACGGGCACGAAAGGACTTCTCAGTACACAGGAACCTCTCCTCACCCAGCGACCTCTCCTCCTGCAGGGAGCTCCCGCCCCCCCATGCAGCTGGACTCCACCTCAGCAGAGGACACCAGTCCAGCTCTCAGCAGTGGCAGCTCTAAGCCCAGGGTGTCCATCCCGATGGTCCGCATACTGGCCCCAGTCCTGGTGCTGCTGAGCCTTCTGTCAGCCGCAGGCCTGATCGCCTTCTGCAGCCACCTGCTCCTGTGGAGAAAGGAAGCTCAACAGGCCACGGAGACACAGAGGAACGAGAAGTTCTGCCTCTCACGCTTGAACTCCCTGATGTTTTCTCTGAGCCTGCCTTGGCTC

MRLLVLLWGCLLLPGYEALEGPEEISGFEGDTVSLQCTYREELRDHRKYWCRKGGILFSRCSGTIYAEEEGQETMKGRVSIRDSRQELSLIVTLWNLTLQDAGEYWCGVEKRGPDESLLISLFVFPASPGLYPAATTAKQGKTGAEAPPLPGTSQYGHERTSQYTGTSPHPATSPPAGSSRPPMQLDSTSAEDTSPALSSGSSKPRVSIPMVRILAPVLVLLSLLSAAGLIAFCSHLLLWRKEAQQATETQRNEKFCLSRLNSLMFSLSLPWL

Waiting for Upload……

WZ Biosciences' products are to be used only for research purpose only. They may not be used for any other purposes, including, but not limited to, in vitro diagnostic purposes, therapeutics, or in humans.


WZ Biosciences' products may not be transferred to any third parties, resold, modified for resale, or used to manufacture commercial products or to provide a service to other third parties without prior written approval from WZ Biosciences, Inc.

Your use of this product is also subject to compliance with the licensing requirements listed above and described on the product's web page at http://www.wzbio.com. It is your responsibility to review, understand and adhere to any restrictions imposed by these statements.